SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2FXS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2FXS5
Domain Number 1 Region: 283-540
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.67e-93
Family Ankyrin repeat 0.0000229
Further Details:      
 
Domain Number 2 Region: 126-249
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000549
Family Pseudo ankyrin repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2FXS5
Sequence length 556
Comment (tr|A2FXS5|A2FXS5_TRIVA) Uncharacterized protein {ECO:0000313|EMBL:EAX90286.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_272180 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MSEQDVNPNRYNELRSICQYHIDIYNALYQLKTENNEDLKSIYKQIKTELIDSKNRHPKS
IIKDILMIIQFNNRYTKSYLTLAKFVCDDYHITEVSDIPIVSSFLFYKEYGIKLDKSGHF
GNIESENLDIHTEDTIYSAIMYNDLERFICFTEREGFDKNQRLQSSLYPYCCYGYSLLEL
CCYHGAVDCFKFLRTNFNSEITGVCLQFSFLGGNKDIMSECLKYQKPNHVCMRNVIISHN
IDFVTFLMNEYNLIIELDYCKAFNNVESFLVYFDQTNDINKCFVYSAKFDIPSLCEYFLS
HGANINEKYDGSTALHYAALNSSKDTGEVLISHGADINEKDKHGQTALHIALHNNNKEIA
ELLISHGANINEKDYQERISLHYAAENNNKETAELLISLGANINEKDEYGKTALHCAAEK
NNKETAELLISHGANINEKDKNGKTVLHLAPHFGGKEIAELLISHGANINEKDNDGQTAL
HYAAENNSKETAEVLLSYGANVNEKDNDGQTALHYTPHFDGKEIAELLLSYGANVNEKDN
DEKPLFIMHHILMVKK
Download sequence
Identical sequences A2FXS5
89292.m00031 XP_001303216.1.43485 5722.A2FXS5 gi|121884578|gb|EAX90286.1| gi|123408544|ref|XP_001303216.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]