SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2G205 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2G205
Domain Number 1 Region: 223-441
Classification Level Classification E-value
Superfamily Ankyrin repeat 3e-75
Family Ankyrin repeat 0.0001
Further Details:      
 
Domain Number 2 Region: 59-188
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000248
Family Pseudo ankyrin repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2G205
Sequence length 444
Comment (tr|A2G205|A2G205_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAX88819.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_300180 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MEDILNIIPYNNRYTKSYLSLAKLISDDYHVEEAYEAKSISNFLFYKEYGYKLDNSITYG
RLDSENLDIHTENTIYRAIMYNDLERFISFTEIEDFDKDQTLNSSLYPDSYEGYSLLELC
CYHGAVDCFKFLRTKFSSEITETCLRFSFLGGNHEIMSECLKYQTPNEKCMEYAIISHNI
DFVTFLMNEYNLEIDLDYCGWYCNLESFFVYFDQTNDIDECFINSAMFNIPSLCEYFLSN
GININEKDNSGKTALHNAARYNCKETAELLISHGANINEKDQEGETALHIAVKYNCKEMA
ELLISHGININEKDINGQNALHCAAWNNRKETAELLISHGININEKDNNGKTALHCAAWN
NRKETAELLISHGININEKDNNGKTALHYAAWNNRKETAELLISHGININEKDNNGKTAL
DIATSNIKSLISHSVNINEQNIDH
Download sequence
Identical sequences A2G205
XP_001301749.1.43485 90348.m00042 5722.A2G205 gi|121882969|gb|EAX88819.1| gi|123400866|ref|XP_001301749.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]