SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2G2D6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2G2D6
Domain Number 1 Region: 285-667
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.08e-151
Family Ankyrin repeat 0.00000251
Further Details:      
 
Domain Number 2 Region: 128-146,177-311
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000000497
Family Pseudo ankyrin repeat 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2G2D6
Sequence length 671
Comment (tr|A2G2D6|A2G2D6_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAX88693.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_134700 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MSDQDAHPNKYGELRSNYKYYIDIYNALYQLKTEKEEELNSIYKMIKTELIDSNKYPPES
MIRGILNLVPYNNHSAKSYLSLAKLISDEYQIKEVNEVATISNFLFYKEYGIKLNKSDDF
EKDDLKNLDIHTENTIYKAIMNNDKENFIIFTERDGFDKDQKLNSDLYPFSYEGYSFLEL
CCYHGAVDCFKLLRSKFKSEITDLCLEFSFLGGNPEIMSECLKYQTPTDECMFYAIVSHN
IDFVTFLMNEYNIEINLEYCGLWDNLESFLVNFDQTNDINKCFVYSSIFNIPSLLEYFLS
HGANIDEKNKDGETALRRAALNNSKEVAEVLISHGANINEKDEDGKTALHIAALNNSKEV
AEVLISHGANINEKDEDGETALHIAALNNSKEVAEVLISHGANINEKDEDGKTALHIAAL
NNSKEVAEVFISHGANINEKDEDGETPLHIAALNNSKEVAEVLISHGANIDEKNKDGETA
LRRAALRNSKEVAEVLISHGANINEKDEDGKTALHIAALNNSKEVAEVFISHGANINEKD
EDGETPLHIAALNNSKEVAEVLISHGANIDEKNKDGETALRRAALRNSKEVAEVLISHGA
NIDEKDEDGKTALHIAALNNSKEVAEVLISHGANIDEKDEDGETALHIAVNENNTEIAEV
LISHGANNVLT
Download sequence
Identical sequences A2G2D6
5722.A2G2D6 84761.m00041 XP_001301623.1.43485 gi|121882826|gb|EAX88693.1| gi|123400230|ref|XP_001301623.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]