SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2GDU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A2GDU7
Domain Number - Region: 88-195
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00314
Family Pseudo ankyrin repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A2GDU7
Sequence length 200
Comment (tr|A2GDU7|A2GDU7_TRIVA) Uncharacterized protein {ECO:0000313|EMBL:EAX84670.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_017290 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MKLTTLTTNDFITVMDQSRSSIKAKELYMCTRNANISVQNFEDIVSILKSLQKYMKLRIL
DGVINFLIQTHKEISSSSEKIQNPQSEETFQNQPPKSDKKFELLNSQLNQINEKNSKERE
ILAEISELKKSNDFERVYNFLDQLSSQGNRKMISKSCDEGLLEKKYQKSPDDIEHVLHVA
SEKGNLSLVKSLMNMASTKI
Download sequence
Identical sequences A2GDU7
XP_001297600.1.43485 80792.m00011 5722.A2GDU7 gi|121877825|gb|EAX84670.1| gi|123373290|ref|XP_001297600.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]