SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2H2D7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A2H2D7
Domain Number - Region: 55-88
Classification Level Classification E-value
Superfamily Outer membrane lipoprotein 0.0366
Family Outer membrane lipoprotein 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2H2D7
Sequence length 129
Comment (tr|A2H2D7|A2H2D7_TRIVA) Uncharacterized protein {ECO:0000313|EMBL:EAX76429.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_539360 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MNSSRLKKLTPMNSSRIITSSRPQSTLNSSRTIRITTQRPEKRTIRASTTSISGNQSLSE
QFTRLNQEIAQIQCEVKPLRSQYIALQNSLLEKQQKSNFNDEIDPEDDDQAVNKEEFQTA
KFKFENERR
Download sequence
Identical sequences A2H2D7
113722.m00005 XP_001289359.1.43485 gi|121860233|gb|EAX76429.1| gi|123261761|ref|XP_001289359.1| 5722.A2H2D7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]