SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2H820 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A2H820
Domain Number - Region: 52-65
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 0.0288
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A2H820
Sequence length 81
Comment (tr|A2H820|A2H820_TRIVA) Uncharacterized protein {ECO:0000313|EMBL:EAX74447.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_525800 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MFVSRAIVDENTDKQVIYEFETKNGVTRLVRFKDSEGDHEIKRKLPRKEYKMDWLPPPPP
PPPLPVPQVNKPFPFPRIPTF
Download sequence
Identical sequences A2H820
107191.m00005 XP_001287377.1.43485 5722.A2H820 gi|121854694|gb|EAX74447.1| gi|123238460|ref|XP_001287377.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]