SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A3I3D6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A3I3D6
Domain Number - Region: 23-74
Classification Level Classification E-value
Superfamily Dom34/Pelota N-terminal domain-like 0.00051
Family Dom34/Pelota N-terminal domain-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A3I3D6
Sequence length 131
Comment (tr|A3I3D6|A3I3D6_9BACT) Uncharacterized protein {ECO:0000313|EMBL:EAZ79073.2} KW=Complete proteome; Reference proteome OX=388413 OS=Algoriphagus machipongonensis. GN=ALPR1_13739 OC=Algoriphagus.
Sequence
MNGRQTIMIAALSGALAVGIGAFGAHGLADILTANGRIETYETAVKYHFYHSLALLLIGT
ILLIKPNWKSLQFSIWSMILGILIFPGSLYALSLTGVTWWGAVTPIGGVFFIMGWLGLFY
AALRNDQIVVD
Download sequence
Identical sequences A3I3D6
WP_008201327.1.81609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]