SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A3PCJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A3PCJ2
Domain Number - Region: 30-123
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0484
Family Pseudo ankyrin repeat 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A3PCJ2
Sequence length 131
Comment (tr|A3PCJ2|A3PCJ2_PROM0) Uncharacterized protein {ECO:0000313|EMBL:ABO17467.1} KW=Complete proteome; Reference proteome OX=167546 OS=Prochlorococcus marinus (strain MIT 9301). GN=P9301_08441 OC=Prochlorococcus.
Sequence
MKIFSNLFYFYLSFLLFILNFASYSYAIGNVEWVLLKENDDGKEWLDKGSIKPLPNGEIS
VLTKFFKNPTNSDDDGELSLYVMRINCNEKKFKDTSINGIPQFNSKWQTSNNDELIDVVI
ENSCSEFINNG
Download sequence
Identical sequences A3PCJ2
WP_011862819.1.29415 gi|126696182|ref|YP_001091068.1| 167546.P9301_08441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]