SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A3R6Y9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A3R6Y9
Domain Number 1 Region: 43-253
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 7.59e-120
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.0000000199
Further Details:      
 
Domain Number 2 Region: 1-42
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 3.26e-18
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A3R6Y9
Sequence length 253
Comment (tr|A3R6Y9|A3R6Y9_9ARCH) Methyl coenzyme M reductase alpha subunit {ECO:0000313|EMBL:ABN68988.1} OX=115547 OS=uncultured archaeon. GN=mcrA OC=Archaea; environmental samples.
Sequence
AMQIGMSFIDAYKMCAGEAAVADLAFAAKHASLVEMADILPARRARGPNEPGGLPFGYLA
DIVQTNRKCPDDPVKSSLEVVAAGCMLYDQIWLGSYMSGGVGFTQYATAAYTDDILDDFM
YYGYDYAKGKYKIGATKATMDVVNDLGTEVTLYGIEQYEKYPTTLEDHFGGSQRATVLAA
ASGCTTALATGNSNAGLSAWYLSMYLHKEAWGRLGFFGYDLQDQCGATNVSSCRSDEGAI
DELRGPNYPNYAM
Download sequence
Identical sequences A3R6Y9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]