SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A4BCW5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4BCW5
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily MTH889-like 2.22e-28
Family MTH889-like 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A4BCW5
Sequence length 94
Comment (tr|A4BCW5|A4BCW5_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:EAR10047.1} KW=Complete proteome; Reference proteome OX=314283 OS=Reinekea blandensis MED297. GN=MED297_08161 OC=Saccharospirillaceae; Reinekea.
Sequence
MIKLTRLVLDVLKPHQPNSYAFATRLAEVKPGLVVNLMVVEMDEHTHTIQLEIVGSDIPL
DEIEDAINELGGSLHSIDEVQVENTTDDSSVGDA
Download sequence
Identical sequences A4BCW5
WP_008045702.1.82470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]