SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A4EIS7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A4EIS7
Domain Number - Region: 20-85
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 0.1
Family Methyl-coenzyme M reductase gamma chain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A4EIS7
Sequence length 92
Comment (tr|A4EIS7|A4EIS7_9RHOB) Uncharacterized protein {ECO:0000313|EMBL:EBA12490.1} KW=Complete proteome; Reference proteome OX=391593 OS=Roseobacter sp. CCS2. GN=RCCS2_14374 OC=Rhodobacteraceae; Roseobacter.
Sequence
MQQERAEVIALQGLAWLAANDELCPLFLGASGASVDDLRERATDPAFLAAVLEFITMDDA
WVVLFCDTVGLGYDQPLRARYALPGAESVHWT
Download sequence
Identical sequences A4EIS7
WP_008233627.1.18621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]