SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A4FZ72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4FZ72
Domain Number 1 Region: 1-92
Classification Level Classification E-value
Superfamily MTH889-like 3.14e-34
Family MTH889-like 0.0000495
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A4FZ72
Sequence length 97
Comment (tr|A4FZ72|A4FZ72_METM5) Uncharacterized protein {ECO:0000313|EMBL:ABO35506.1} KW=Complete proteome OX=402880 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333). GN=MmarC5_1208 OC=Methanococcaceae; Methanococcus.
Sequence
MTKLRRMVLDVLKTHEPKLTDLAVKLCSVDGIDGVNVTVYEIDKSTENIKITIEGFNLDY
EAIKAIIESMNGVIHSIDEVAAGKKLIDEVKTPQDRY
Download sequence
Identical sequences A4FZ72
402880.MmarC5_1208 WP_011868959.1.72418 gi|134046235|ref|YP_001097720.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]