SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A4G0Q1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A4G0Q1
Domain Number - Region: 74-156
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 0.0432
Family Fibrinogen coiled-coil and central regions 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A4G0Q1
Sequence length 186
Comment (tr|A4G0Q1|A4G0Q1_METM5) Flagella accessory C family protein {ECO:0000313|EMBL:ABO36035.1} KW=Complete proteome OX=402880 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333). GN=MmarC5_1738 OC=Methanococcaceae; Methanococcus.
Sequence
MPNISEIIEEIKQKIKLGKKTEKTSEAESDDEFSFALEEETVSESEDLIAANEELLAKIG
ELESKFPKIEMMVTNLRKENENLRSDIQSITENFQDMMALYEVVSNQINPFIGISKITAT
SMEKVEKMESESQNLKKRVEELQNDVVVLANVYLNTHQIDLDGVINEVLAEEEFSKAISG
EDSDDW
Download sequence
Identical sequences A4G0Q1
gi|134046764|ref|YP_001098249.1| 402880.MmarC5_1738 WP_011869481.1.72418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]