SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A4GDB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A4GDB3
Domain Number - Region: 275-379
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000628
Family Pseudo ankyrin repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A4GDB3
Sequence length 737
Comment (tr|A4GDB3|A4GDB3_9POXV) Uncharacterized protein {ECO:0000313|EMBL:ABD52516.1} KW=Complete proteome OX=10245 OS=Vaccinia virus. GN=List054 OC=Orthopoxvirus.
Sequence
MISVTDIRRAFLDNECHTITKAFGYLHEDKAIALIKIGFHPTYLPKVLYNNVVEFVPEKL
YLFKPRTVAPLDLISTITKLKNVDKFASHINYHKNSILITGDKSLIVKCMPYMIISDDDI
RFIREQFVGTNSIEYILSFINKESIYRMSYQFSENEIVTIINRDHFMYEPIYEHQVLDSD
FLKTMLDRYGIVPINSGIIDELCPEAIIEILMAVVRPRDAIRFLDIVNKNQLTEDSVKNY
IINDIRRGKIDYYIPYVEDFLEDRTEDLGIYANIFFEDAIDITKLDITKTELEHISKYMN
YYTTYIDHIVNIILQNNYIDILASIIDYVQDVLTEELCIRIVCESTNPVPVTSLPIHSTL
VMVMCIQMKYVDIVEFLDEIDIDTLIEKGADPITEYTFTTRWYNKHNDLITLYIKKYGFC
PMMMKRLMFEYPLTKEASDHLLKTMDENRGAIMFFPRTICTLPYLLCCNYKLIQKPIPFK
EENRNIVYKKNNRVLCFDSLENSAFKSLIKIDSIPGLKTYNMKDITYEKSNNIICVRFIP
QESIHNEERRIKLQLFDIARLASYGLYYIPSRYLSSWTPVVNMIEGREYTNPQKIECLVI
LDLFSEEFIEYQNLGNAVSNKYELEYTISNYQAAINCLMSTLLIYLVLGSIRSISKTEDF
VLSILNIFYKGLKINELLSEPVSGVCIELDKIKDRASSGDSSFIFLKKNELSKTLSLCEK
VCVETILDNNQSFKSSK
Download sequence
Identical sequences A4GDB3 B9U1C9
A4GDB3_9POXV B9U1C9_9POXV

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]