SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A4H6V7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4H6V7
Domain Number 1 Region: 5-147
Classification Level Classification E-value
Superfamily MAL13P1.257-like 1.44e-33
Family MAL13P1.257-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A4H6V7
Sequence length 153
Comment (tr|A4H6V7|A4H6V7_LEIBR) Uncharacterized protein {ECO:0000313|EMBL:CAM37417.1} KW=Complete proteome; Reference proteome OX=5660 OS=Leishmania braziliensis. GN=LBRM_12_0440 OC=Leishmaniinae; Leishmania; Leishmania braziliensis species complex.
Sequence
MTVEESEGVEQIVPAKNRTWGLRFQCASCNEESTGMMYVHVAEQYERDGGTHNLIFKCKL
CKADITADVLPVPAGTGYYSAEENSANVIAAFEVRGGRPVELEIDNQWIVVAAGGGSFED
ADLSQEWYDYDEGAQAAVSVVGVSIGFEKSKKK
Download sequence
Identical sequences A0A088S4G7 A4H6V7
XP_001563094.1.15230 XP_010697024.1.42505 psu|LbrM12_V2.0440 gi|154333675|ref|XP_001563094.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]