SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A4K2Z1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4K2Z1
Domain Number 1 Region: 53-86
Classification Level Classification E-value
Superfamily p53-like transcription factors 0.00000000166
Family DNA-binding protein LAG-1 (CSL) 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A4K2Z1
Sequence length 86
Comment (tr|A4K2Z1|A4K2Z1_CHLAE) Recombining binding protein L, 5 prime {ECO:0000313|EMBL:ABO53026.1} OX=9534 OS=Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops). GN=RBPSUHL OC=Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Sequence
MDPAEAADPSMPPNPLTHLSLRDRSEMQLQSEADRRSLPGTWTRSSPEHTTILRGGVRRC
LQQQCEQTVRIVHAKVAQKSYGNEKR
Download sequence
Identical sequences A4K2Z1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]