SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A4RQV5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4RQV5
Domain Number 1 Region: 6-345
Classification Level Classification E-value
Superfamily Clathrin heavy-chain terminal domain 7.85e-122
Family Clathrin heavy-chain terminal domain 0.0000000371
Further Details:      
 
Domain Number 2 Region: 1199-1531
Classification Level Classification E-value
Superfamily ARM repeat 3.57e-97
Family Clathrin heavy chain proximal leg segment 0.0000000152
Further Details:      
 
Domain Number 3 Region: 457-792
Classification Level Classification E-value
Superfamily ARM repeat 5.47e-78
Family Clathrin heavy-chain linker domain 0.0025
Further Details:      
 
Domain Number 4 Region: 348-500
Classification Level Classification E-value
Superfamily ARM repeat 1.32e-46
Family Clathrin heavy-chain linker domain 0.0000119
Further Details:      
 
Domain Number 5 Region: 900-1066
Classification Level Classification E-value
Superfamily ARM repeat 1.29e-35
Family Clathrin heavy-chain linker domain 0.029
Further Details:      
 
Domain Number 6 Region: 1050-1196
Classification Level Classification E-value
Superfamily ARM repeat 1.87e-30
Family Clathrin heavy chain proximal leg segment 0.0069
Further Details:      
 
Domain Number 7 Region: 809-914
Classification Level Classification E-value
Superfamily ARM repeat 0.00000213
Family MIF4G domain-like 0.066
Further Details:      
 
Weak hits

Sequence:  A4RQV5
Domain Number - Region: 1499-1592
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0732
Family Pseudo ankyrin repeat 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A4RQV5
Sequence length 1688
Comment (tr|A4RQV5|A4RQV5_OSTLU) Clathrin heavy chain {ECO:0000256|PIRNR:PIRNR002290} KW=Complete proteome; Reference proteome OX=436017 OS=Ostreococcus lucimarinus (strain CCE9901). GN=OSTLU_28794 OC=Mamiellales; Bathycoccaceae; Ostreococcus.
Sequence
MAAPAVPVTVKEAIQLKTCGVNPQCISFTNLTMESEKYVCARESGTTNNVVIVEVNNPLQ
PMKKPITADSALMNPTQNVIALKARVENENGVEDSLQIFNIDQKAKIKGHDMEPVVFWKW
ITPKMLGIVTNTAVFHWSIDDANAPVKVFDRTANLNGNQIISYKASEDMQWFTLIGIAQG
DASRPALVKGNMQLYSVAQQRSQPLEAHMAAFTTHQVPGNAQKSQLVCFAQKMVQADGSV
VSKLHVIELGAPAGQTPFTKRTSELFFPPEFADDFPVVMQVSDKYGVIYIVTKSGLLFVY
DVETASPIYRSRISQDPVFVGASATSVGGLYVVNRGGQVLLITLNEAAVVPFISSTLNNL
ELALSVASRGNLPGADALVMPKFDMLFNSADYKGAAELAASMSSLRTDQTIARFRGVPTQ
PGQSSPLLQYFGACLQRGKLNKLESVELAKLVLAQNKKQLLDTWLSEDKLEASEELGDML
APTDSDTALKIYVKARASPKVTAAFAQRGEFDKMAQYCSAVDYKPDYMYMLQALMMKDPA
SAVQLAQKISQMTPPPCDMGAIADLFLQRNMIREATSILLDLLKGDDESQAALQTKVLEI
NLVTYPNVADAILAQGKLTHYDRPRIAQLCEKAGLYIRAMEHYTELADLKRCVVNTHSID
PQALTEFFGTLSREWALDCLKELLTFNMRQNLQMAVNIAKEYTEQLEIHSVVKMFDKFES
AEGLFYYLGYFVNTCEDKDLVYKFIEAASKTGQIKEVERVTRESDHYDAERVKVFLMEAK
LSDARPLINVCDRYEFVPDLTTYLYNNNMLRYIEGYVQKVNPKQAPKVVGTLLDLECPDD
FIKTLILSVRSLLPVAPLVEEVEKRNRLKILTQFLEHLVNEGSVDPQVHNAMGKMLIDSN
QNPEHFLLTNEYYESAIVGRYCEKRDPYLACVAYKRGNCDAELVDCTNRNSMFKVQARYV
VERMDADLWASVLTEENKYCRQLIDQVVSTALPESKNPEQVSVTVKAFMTAEMPHELIEL
LEKIVLQNSAFSNNPNLQNLLILTAIKADASRVMDYVNRLDSFNGPEVGEIAAGNELYEE
AFAIFKKFDLHVDAMKILLESLEDLDRGIEYARKVDLPEVWVQIGKAQLKVGTPEAVKAA
IKSYIKAQDGSDFVDVIHAARQADMYEDMVPYLLMVRKNKKEARVDTELVYAYAKINDLA
KLEDFLATPNSANQQSVADRCFGEGLYEAARLLYTALSNWGCLASTLLKLRMFQGAVDAA
KKANSPRTWKEVCFTCLEEGENKLAQLAGLNIIIQADELDSVSEYYQANGKFTELIQLME
AGVGVDRAHMGIFTELGILYANHMADKLMEHIRLFSARINIPRLITTCNHVALWPELAYL
YRCYDEYDNACEVMMKHPDAWEHVVFKDVCVKLANADLYYQAIEFYLREHPTEMTNLLGV
LQSRLDHSRVVSLMRKEGKLAMVKEYLLAVQGANLTAVNDAVNELAIEEEDHAALKTSLD
MYDNCDQLSLAVQCESHELIEFRRISSYIYQRNARWQQAIDLSKRDGLLKDAMEIAAKSG
DATIVDELLDYFIDQGNKECFSAALCTCYDLLKPDEVMQKAWLKGLSDWVMPYMIQVMRD
MNGKLEILMKDKADRNEEKVNEEKERVAAEMNSNLYAQLMPAALPAPPMPGMPGYEQPQP
GYGQPQYY
Download sequence
Identical sequences A4RQV5
jgi|Ost9901_3|28794|eugene.0100010188 436017.A4RQV5 XP_001415454.1.19716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]