SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A4S0Y3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4S0Y3
Domain Number 1 Region: 64-142
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000235
Family Pseudo ankyrin repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A4S0Y3
Sequence length 153
Comment (tr|A4S0Y3|A4S0Y3_OSTLU) Uncharacterized protein {ECO:0000313|EMBL:ABO97561.1} KW=Complete proteome; Reference proteome OX=436017 OS=Ostreococcus lucimarinus (strain CCE9901). GN=OSTLU_42331 OC=Mamiellales; Bathycoccaceae; Ostreococcus.
Sequence
MIASARAQVILRTSFAGAQGKRRDALRLRAPSNGAKCTAFFNRFRQDSTAAGIVGSQGRD
DYDKDDVEHYFNYMGCLAVEGTYDRMNALIESGLHPVDIILLFASAEGDTPKIEEILAAG
ADKNTVDLDGNSVADLAGKANPDKRDAVLELLK
Download sequence
Identical sequences A4S0Y3
XP_001419268.1.19716 jgi|Ost9901_3|42331|e_gwEuk.8.470.1 436017.A4S0Y3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]