SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A4S276 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4S276
Domain Number 1 Region: 74-154
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000000000353
Family Pseudo ankyrin repeat 0.023
Further Details:      
 
Weak hits

Sequence:  A4S276
Domain Number - Region: 153-187
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000301
Family Pseudo ankyrin repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A4S276
Sequence length 201
Comment (tr|A4S276|A4S276_OSTLU) Uncharacterized protein {ECO:0000313|EMBL:ABO97993.1} KW=Complete proteome; Reference proteome OX=436017 OS=Ostreococcus lucimarinus (strain CCE9901). GN=OSTLU_33352 OC=Mamiellales; Bathycoccaceae; Ostreococcus.
Sequence
MAKKDPYARLRELIKRRASQTHDCLETCLENVSRGPQRDADGLVCSKLAELGYLEQLKEA
RRLDFPWNEWTSANAAMNGHLKCLKYAHERECPWDWRTCYYATRNGHLECLKYAHEHGCP
WDERTCMNAARSGQLECLKYAHENGCPWNEWTCALAAMDGELECLKYARERGCPWDETQE
MAAENGHEFMSMDTYVQYTNN
Download sequence
Identical sequences A4S276
XP_001419700.1.19716 jgi|Ost9901_3|33352|eugene.0900010056 436017.A4S276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]