SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A4S298 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4S298
Domain Number 1 Region: 3-15,49-132,177-225
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 3.92e-18
Family Pseudo ankyrin repeat 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A4S298
Sequence length 272
Comment (tr|A4S298|A4S298_OSTLU) Uncharacterized protein {ECO:0000313|EMBL:ABO98005.1} KW=Complete proteome; Reference proteome OX=436017 OS=Ostreococcus lucimarinus (strain CCE9901). GN=OSTLU_33374 OC=Mamiellales; Bathycoccaceae; Ostreococcus.
Sequence
MPTTEYRAHVTGDPETCACILRESWPDAAAWPRGQTLSFGTGAFCDFTTLLATRRGHIRC
LKYAVENGCALHPNLLREATDVPTQMQCFKYALELGLEVDYDAVHTACQNTSVTRITLLI
EAYQEQTKRRKRKREDDAKNMIVERGSAFIGAVCANAARGQPGEVIQCIDFLRECGCGWS
ETATWNVARKGVVRVLKHLVENGCPWDDETLASAEKSGDAETIAFAKRHDKKVKQRKSLE
TMFNVIESRKEQMTEQEYIDACRAAKDLHDSL
Download sequence
Identical sequences A4S298
436017.A4S298 jgi|Ost9901_3|33374|eugene.0900010078 XP_001419712.1.19716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]