SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A4SAC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4SAC8
Domain Number 1 Region: 41-153
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 5.62e-20
Family Pseudo ankyrin repeat 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A4SAC8
Sequence length 243
Comment (tr|A4SAC8|A4SAC8_OSTLU) Uncharacterized protein {ECO:0000313|EMBL:ABP00681.1} KW=Complete proteome; Reference proteome OX=436017 OS=Ostreococcus lucimarinus (strain CCE9901). GN=OSTLU_28524 OC=Mamiellales; Bathycoccaceae; Ostreococcus.
Sequence
MTCYELESRERHKKPKIWNGDGVEGKQAIGRARCAVREAARAVRDGCHGDKLLHMCWNNK
SWNVLNDDVLLEAARCGNRECAQTIAEHHHHGEGLTKEGVMRASFAAAESGHYDIVEMLS
DSIAFDLSCSLSTAHYEIALASKNAEFVWRLIRAEAPMACSQMEDVTDLVVSHYTGAIAD
ERERLQIEMMMMKYVENCLDDGSAEWDSQTPTPELDLDSGVDAYETEDAIGNDEKEYTAR
EWR
Download sequence
Identical sequences A4SAC8
XP_001422364.1.19716 jgi|Ost9901_3|28524|eugene.1900010010 436017.A4SAC8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]