SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A4SU74 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A4SU74
Domain Number - Region: 11-65
Classification Level Classification E-value
Superfamily mu transposase, C-terminal domain 0.0314
Family mu transposase, C-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A4SU74
Sequence length 76
Comment (tr|A4SU74|A4SU74_AERS4) Uncharacterized protein {ECO:0000313|EMBL:ABO92446.1} KW=Complete proteome OX=382245 OS=Aeromonas salmonicida (strain A449). GN=ASA_P4G147 OC=Aeromonadaceae; Aeromonas.
Sequence
MKPQIFEEIIMENSTTITTTKGYTLKVLREGLYYQCTHLNGIELTPDYQDVLVLKTDGSF
LCGAAYTPANWAGVKV
Download sequence
Identical sequences A0A189PG89 A4SU74
382245.ASA_P4G147 WP_011899388.1.41377 WP_011899388.1.46813 WP_011899388.1.49680 WP_011899388.1.52154 WP_011899388.1.75420 WP_011899388.1.93610 gi|145301354|ref|YP_001144194.1| gi|145301354|ref|YP_001144194.1|NC_009349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]