SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A4WWC6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4WWC6
Domain Number 1 Region: 32-183
Classification Level Classification E-value
Superfamily ISP domain 1.09e-37
Family Rieske iron-sulfur protein (ISP) 0.000053
Further Details:      
 
Weak hits

Sequence:  A4WWC6
Domain Number - Region: 4-44
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 0.0458
Family ISP transmembrane anchor 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A4WWC6
Sequence length 187
Comment (tr|A4WWC6|A4WWC6_RHOS5) Ubiquinol-cytochrome c reductase iron-sulfur subunit {ECO:0000256|RuleBase:RU004494} KW=Complete proteome; Reference proteome OX=349102 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3). GN=Rsph17025_2803 OC=Rhodobacteraceae; Rhodobacter.
Sequence
MSNAEDHAGTRRDFLYYATAGAGAVATGAAVWPLINQMNPSADVQALASIFVDVSAVDPG
VQLTVKFLGKPIFIRRRTEVDIEAARAVQLSQLPDQSARNANIEGGADASDQNRTLDEAG
EWLVMWGVCTHLGCVPIGGASGDFGGWFCPCHGSHYDSAGRIRKGPAPENLPIPLAQFID
ETTIQLG
Download sequence
Identical sequences A4WWC6
349102.Rsph17025_2803 WP_011909751.1.61369 gi|146278836|ref|YP_001168995.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]