SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5BP63 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A5BP63
Domain Number - Region: 8-103
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000235
Family Pseudo ankyrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A5BP63
Sequence length 297
Comment (tr|A5BP63|A5BP63_VITVI) Uncharacterized protein {ECO:0000313|EMBL:CAN68156.1} OX=29760 OS=Vitis vinifera (Grape). GN=VITISV_036768 OC=Pentapetalae; rosids; Vitales; Vitaceae; Vitis.
Sequence
MHTLTLQLLNHLCTEVLKVSRAKEIFRQSFINGAKYGIPEILEEIIKSYPYALEYLDEDV
FKLAVLNRYEKIFNLICETGMHRQLIIRTRDDSNNDNILHLAGKLAPPHRLSLVSGAALQ
MQRELHWFKKLFDFYTAKFYTLAAALLATVVFAAAITIPGGNHDDTGTPNFSKEIAFKVF
AVSDALSLFLSIASALICLSILTTRYAEDDFLFALPRRLIFGLVTLFLSVTFMMIAYSSA
IYLLFGEKKAWILITLAALACLPVTLYGILQFPLLVELIYSTYGPGIFGKHSNRLIR
Download sequence
Identical sequences A5BP63

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]