SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5CEJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A5CEJ0
Domain Number - Region: 129-288
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0432
Family Pseudo ankyrin repeat 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A5CEJ0
Sequence length 492
Comment (tr|A5CEJ0|A5CEJ0_ORITB) Uncharacterized protein {ECO:0000313|EMBL:CAM80573.1} KW=Complete proteome; Reference proteome OX=357244 OS=Orientia tsutsugamushi (strain Boryong) (Rickettsia tsutsugamushi). GN=OTBS_1492 OC=Rickettsiaceae; Rickettsieae; Orientia.
Sequence
MKKKITIVIIVLVALITVNFAADGCGEKSMVLSNFELAASRLGFNGYKTSNLTVSATEHQ
EALLNVLQIAGYFHSEQLWQAINALKVKDPVATFKQIYSVVKASGANQDDPSKFDTKILR
KNFGEGTELSIQDIMDLILYLSQNAFNRTFGQERSEVVAQNWMAKYKDEYLKEAEILQLI
DREIPKYKHYDVAWIAGASRFNMITRIIDYYYAISKYNIKINSNVAVLTGNRELWANIDG
VVPTVLEKLIHAYQTNLNFDLLDIDNSDIKRVDEGKEYILRLAKKYHIKLNSLSPFIQYT
NLSECPTGCFPNRLYPDYIESGGIKLNEALMVRDLIDTIFSSKVITIVDETVGVDSYRST
TESTVHDATIEFLEDVINTNEYVNKKEFIILFQSNNPFILRQTIVTQRQVNEVVDYYNKL
YGKDYSIQVDGIGYKCKADVSIIHSEFAALVLEKWKDATNKNKNLASKRSINDLQFQNRD
HSETILPMLAIS
Download sequence
Identical sequences A5CEJ0
gi|148284804|ref|YP_001248894.1| WP_011944913.1.173 357244.OTBS_1492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]