SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5DS30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A5DS30
Domain Number 1 Region: 2-259
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.49e-56
Family Capz alpha-1 subunit 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A5DS30
Sequence length 266
Comment (tr|A5DS30|A5DS30_LODEL) Uncharacterized protein {ECO:0000313|EMBL:EDK41988.1} KW=Complete proteome; Reference proteome OX=379508 OS=NBRC 1676 / NRRL YB-4239) (Yeast) (Saccharomyces elongisporus). GN=LELG_00166 OC=Candida/Lodderomyces clade; Lodderomyces.
Sequence
MSVQLQDLITSLVESAPSTELSSVAENLGAITTGISKSTIENAIAEFINSTPIAISGYII
SKFNKDSQSSKYIDFVKEEKFNFDVLKNRIIDVESYSTDGQINANLVKKLEEYGEDYYRD
FTFNIIPEGFADDNDKSFRIIIIGQKQNQNNFYTGAWRSEYKVNGDQITGVVALDIHYFE
EGNVRLKYTDDEISGTLGKSGDASGIVNFINKLENAIELKIIEQFQSLNQQSFKNLRRVL
PVTRSKINWGNAIGNYRLGSDVVNKK
Download sequence
Identical sequences A5DS30
XP_001527646.1.59662 LELT_00166 36914.A5DS30

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]