SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5KZK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A5KZK5
Domain Number - Region: 351-401
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0314
Family Pseudo ankyrin repeat 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A5KZK5
Sequence length 463
Comment (tr|A5KZK5|A5KZK5_VIBBS) Uncharacterized protein {ECO:0000313|EMBL:EDK29201.1} KW=Complete proteome OX=391574 OS=Vibrionales bacterium (strain SWAT-3). GN=VSWAT3_04241 OC=unclassified Vibrionales.
Sequence
MPFSKHQIEQLSTPLSDDSICGVYLKLDKGAFRPLRNEFNVAQTALRKLSQNPSADEKDA
LQEACLNSWKTLSDSLFEQFSKTTRDIELISWFVAAQFLLDTTLESAANSLEWLADLSEK
YWDHLNPVLPVEKLKSDDDKGKEREQADAKVKAFFQLVGDSEESSILYAPMLQLPLVGEV
TFFDFQSAERKGEISQLKSTLTTTVAQERSAIQFKMENAKRCIFQLERLSTLVSTHCQSV
GSQTTNFGFAKSLLTLVENALVHLSGIKLAPKAEAKAVEQEVAESSVSEGDQPNHMDPKQ
IEPIPMPSEQAQTVSQHLHAGNLSELGNFNNMNRDLAFHLLREVSDYFRQSEPHSPISFL
LEKAIRWGYLSLPELLQEMMSEQNGDALSTIFNAAGLNHLDQVLLPEMSTPTVDIESPQT
PQATPPVSEPPSVEEHVSQTSPVDTQSKQDEKPQSSATSALSW
Download sequence
Identical sequences A5KZK5
WP_008219016.1.39633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]