SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5M9B5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A5M9B5
Domain Number - Region: 19-54
Classification Level Classification E-value
Superfamily SARS Nsp1-like 0.00183
Family SARS Nsp1-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A5M9B5
Sequence length 62
Comment (tr|A5M9B5|A5M9B5_STREE) Uncharacterized protein {ECO:0000313|EMBL:EDK65725.1} KW=Complete proteome OX=406560 OS=Streptococcus pneumoniae SP14-BS69. GN=CGSSp14BS69_02644 OC=Streptococcus.
Sequence
MKIKEQTRKLAAGCSKHCFEVVDRTDEVSSKHGFEVVDRTDEVSNHTYGKATLTWFEEIF
EE
Download sequence
Identical sequences A5M9B5
WP_001811205.1.101875 WP_001811205.1.21426 WP_001811205.1.44402 WP_001811205.1.5024 WP_001811205.1.7310 WP_001811205.1.82279 WP_001811205.1.82680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]