SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5N6V0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A5N6V0
Domain Number 1 Region: 24-139
Classification Level Classification E-value
Superfamily TM1646-like 5.49e-35
Family TM1646-like 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A5N6V0
Sequence length 140
Comment (tr|A5N6V0|A5N6V0_CLOK5) Uncharacterized protein {ECO:0000313|EMBL:EDK33031.1} KW=Complete proteome; Reference proteome OX=431943 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680). GN=CKL_0989 OC=Clostridium.
Sequence
MEVSRIGRSSAPSSKNKSIKIKKDFSQSFNSQMEKKSEQELKNMFDNIKKKGNRLSITKC
YADVRSYKKMIQEYLESVLKYMYNVKKDISFWQTQYFITVDTIDRKLEELTELLMNEQKE
NLNIAATIDDISGLLVDIYK
Download sequence
Identical sequences A5N6V0 B9E0B9
gi|219854236|ref|YP_002471358.1| 431943.CKL_0989 583346.CKR_0893 gi|153953614|ref|YP_001394379.1| WP_012101361.1.77168 WP_012101361.1.89246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]