SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5PD41 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A5PD41
Domain Number - Region: 52-105
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 0.0294
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A5PD41
Sequence length 162
Comment (tr|A5PD41|A5PD41_9SPHN) Uncharacterized protein {ECO:0000313|EMBL:EDL48161.1} KW=Complete proteome; Reference proteome OX=161528 OS=Erythrobacter sp. SD-21. GN=ED21_31459 OC=Erythrobacteraceae; Erythrobacter.
Sequence
MTDALLLIPGIELLERTSSSIRVQNVVQLSMAPAFLLAGIGAVMNVMTNRLIWVANKIEK
ILKASDGDEGNELLVELPALERRRVLAQRAVMLSTASAFTISIVIMLLFVSAFVKAPLGT
FVALTWLITMGLLMAGLAAFLLETRVAARRNRERMEERTFGP
Download sequence
Identical sequences A5PD41
WP_006834067.1.64301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]