SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5UFJ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A5UFJ4
Domain Number - Region: 24-52
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 0.0523
Family PA0094-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A5UFJ4
Sequence length 66
Comment (tr|A5UFJ4|A5UFJ4_HAEIG) CitXG {ECO:0000313|EMBL:ABQ99549.1} KW=Complete proteome OX=374931 OS=Haemophilus influenzae (strain PittGG). GN=CGSHiGG_02580 OC=Pasteurellaceae; Haemophilus.
Sequence
MQHFFTTFSTEGSKISLEALLNAREERAILQQQLITQYGQTLLCITLTAVGGVKKMLCWI
MFLQKL
Download sequence
Identical sequences A5UFJ4
gi|148827180|ref|YP_001291933.1| 374931.CGSHiGG_02580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]