SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5VW46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A5VW46
Domain Number - Region: 8-82
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0497
Family Pseudo ankyrin repeat 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A5VW46
Sequence length 102
Comment (tr|A5VW46|A5VW46_FUSNP) Uncharacterized protein {ECO:0000313|EMBL:ABQ59637.1} KW=Complete proteome OX=393480 OS=Fusobacterium nucleatum subsp. polymorphum ATCC 10953. GN=FNP_pFN3g02 OC=Fusobacterium.
Sequence
MENIKKKKNNLDAIIKVLETYNINANDLKKLNELQIIKQKNLDIIKLLTKLESGFKSKKI
KFVTAEETQEKILKILNDIVPATKKNNKKNKEQQNLENNINS
Download sequence
Identical sequences A5VW46
WP_011950376.1.22842 WP_011950376.1.64479 gi|148557805|ref|YP_001259981.1|NC_009506 gi|148557805|ref|YP_001259981.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]