SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A6DJD8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6DJD8
Domain Number 1 Region: 5-66
Classification Level Classification E-value
Superfamily Pili subunits 9.42e-16
Family Pilin 0.01
Further Details:      
 
Weak hits

Sequence:  A6DJD8
Domain Number - Region: 175-225
Classification Level Classification E-value
Superfamily Fungal immunomodulatory protein, FIP 0.0131
Family Fungal immunomodulatory protein, FIP 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A6DJD8
Sequence length 267
Comment (tr|A6DJD8|A6DJD8_9BACT) Uncharacterized protein {ECO:0000313|EMBL:EDM28012.1} KW=Complete proteome; Reference proteome OX=313628 OS=Lentisphaera araneosa HTCC2155. GN=LNTAR_11686 OC=Lentisphaeraceae; Lentisphaera.
Sequence
MKKKFTLIEILVVVAIIGILASLLLPSLKKARESARRATCINNEKQIGISFALYQDDNEG
YYPIYGTTFEDDISWDDMLSDYDGREISDADKLTEELRIDEYSVGSYLCGSNIQNRDPIL
IKSYAINDSYSGDSVRGIAGWKDDAGWSTAINDVVNTSNFIILNEVQFWSNKMGSTGAWG
EGGPRDFADGLSVAKVESKQKAEDKGGIKGFYIHDSKSYKMNFLFSDGHVKYRTVPSTMG
DGASAFYDGSGRNWSYFVDTPWNSLSD
Download sequence
Identical sequences A6DJD8
WP_007278009.1.13012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]