SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A6EPK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A6EPK3
Domain Number - Region: 63-196
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0889
Family Capz beta-1 subunit 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A6EPK3
Sequence length 296
Comment (tr|A6EPK3|A6EPK3_9BACT) Uncharacterized protein {ECO:0000313|EMBL:EDM44792.1} KW=Complete proteome; Reference proteome OX=50743 OS=unidentified eubacterium SCB49. GN=SCB49_14510 OC=Bacteria; Bacteroidetes; environmental samples.
Sequence
MKKAFLYLFMGATFIQCTADQEGETTVENQNLTYEKGLDLSTQLPNANFDTANSGLYVGT
AVSNDLTFHERLYINIYNDNHINAQFLINKFTTASYIYLQGSVLNADENTYEFSGEIGSF
KLQIENNEATIYDAIFDNKQAVANVFKSTSKDPLTPTIGTFSANSTDHDADGTWDAIYTE
TNDDRFDGSVISIVLNSTSYTITNSEELSYRRFCNPIEGSENLLSRLICRAQSENDIAQL
AGLPINFHFRIVESNEDLPTCDYPTAAEMVEVQNTWSWNGREGTITLDRSTLPSFD
Download sequence
Identical sequences A6EPK3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]