SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A6H4Z4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A6H4Z4
Domain Number - Region: 37-116
Classification Level Classification E-value
Superfamily TM1646-like 0.0157
Family TM1646-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A6H4Z4
Sequence length 246
Comment (tr|A6H4Z4|A6H4Z4_9NEOP) Tektin {ECO:0000313|EMBL:CAM96522.1} OX=441047 OS=Heliconius ethilla aerotome. GN=tekt OC=Papilionoidea; Nymphalidae; Heliconiinae; Heliconiini; Heliconius.
Sequence
VVDKYSITRYSTGEWRKNNQQMLTPRATDKAHALETQIKTDVNNAFSNMNNKLKDSDNKI
NKRIENLSYWKKKVESTLQAMNKEINTLDDDRARLKGACKILMMPEAISRECLELRTGRY
EPDLVRDDAEQELIKEVAIVGEIRRVFTTTLLQVEEQMARNKAAKSSIEFDWSDKMVTLK
VDMKNVSLSPESNLIICHPGVARWPENATTLEYWEHYCSESIRNCEEVRKASEKLRGDLM
TVITKG
Download sequence
Identical sequences A6H4Z4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]