SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A6Q6G5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6Q6G5
Domain Number 1 Region: 81-111
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000204
Family Prokaryotic DksA/TraR C4-type zinc finger 0.042
Further Details:      
 
Weak hits

Sequence:  A6Q6G5
Domain Number - Region: 13-42
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 0.00327
Family Delta-sleep-inducing peptide immunoreactive peptide 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A6Q6G5
Sequence length 115
Comment (tr|A6Q6G5|A6Q6G5_SULNB) Uncharacterized protein {ECO:0000313|EMBL:BAF71074.1} KW=Complete proteome; Reference proteome OX=387093 OS=Sulfurovum sp. (strain NBC37-1). GN=SUN_0114 OC=Bacteria; Proteobacteria; Epsilonproteobacteria; Sulfurovum.
Sequence
MTKEEKETIRKKIEEDIETLKEQISTLEEKVKPISPDCSLGRLTRLEAMGEQHVNNKILD
ESKVRLTRLQNALLRIDKPMFGICIECEEEIGTGRMSVRPESVRCVECANNAQGV
Download sequence
Identical sequences A6Q6G5
gi|152991710|ref|YP_001357431.1| 387093.SUN_0114 WP_011979807.1.96465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]