SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A6QBV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A6QBV7
Domain Number - Region: 58-139
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.000314
Family beta-lactamase inhibitor protein-II, BLIP-II 0.048
Further Details:      
 
Domain Number - Region: 132-166
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 0.00459
Family MMLV matrix protein-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A6QBV7
Sequence length 298
Comment (tr|A6QBV7|A6QBV7_SULNB) Uncharacterized protein {ECO:0000313|EMBL:BAF72966.1} KW=Complete proteome; Reference proteome OX=387093 OS=Sulfurovum sp. (strain NBC37-1). GN=SUN_2024 OC=Bacteria; Proteobacteria; Epsilonproteobacteria; Sulfurovum.
Sequence
MIKAVILFGIFLLFAGCSHNEVIDPDNSQNQEHKCKQELSKAKDWMASWKTCAGDGAIKK
DGTLWQLGEVGGCNWGQMLPPLDPDTGKPTYTTKYIYHLEPKKIGDGFAGAKIINGGYRV
YAIKKDGTLWGWGEGLRKKPLLLSYSHDWVDFGVKWAGNGCCDHDIGLKKDGSLWILPED
LNYAHKSPLPDLKRVGKQKGWDRVILNCCSMYAMKKDGSLWVNRDRLKGLKFVKFDPKVD
CNTGEASFCKNLRSAFSKMPSQSIYNYYSNYDEMKSQKVKVGGSAGTLCIIPETVYKF
Download sequence
Identical sequences A6QBV7
387093.SUN_2024 gi|152993602|ref|YP_001359323.1| WP_012083785.1.96465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]