SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A6QD09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A6QD09
Domain Number - Region: 37-99
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0523
Family Capz beta-1 subunit 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A6QD09
Sequence length 225
Comment (tr|A6QD09|A6QD09_SULNB) 5-methylcytosine-specific restriction enzyme A {ECO:0000313|EMBL:BAF73368.1} KW=Complete proteome; Reference proteome OX=387093 OS=Sulfurovum sp. (strain NBC37-1). GN=SUN_2434 OC=Bacteria; Proteobacteria; Epsilonproteobacteria; Sulfurovum.
Sequence
MQNNWTKEELKAAVIAYIEMRTKSLNGESFKKKQYYEDLSHRFGRTIKSYEYRMQNISYV
YSLMGRDWLKGLRPAKNVGTRVASEIEEIIKEIENQALSEPVSFQAEVDKLVHKKLQDKP
KAVLEPKRYDIAITKYDRDPQIVAWVLMNAKGICECCNKEAPFVKDDGVPFLEVHHLRRL
ADDGSDSITNAIAICPNCHRELHYGQNKDILLTTIYSQVSRLIRE
Download sequence
Identical sequences A6QD09
WP_012084212.1.96465 gi|152994004|ref|YP_001359725.1| 387093.SUN_2434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]