SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A6R8V1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6R8V1
Domain Number 1 Region: 326-378,414-454,1048-1172
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.28e-26
Family Ankyrin repeat 0.0021
Further Details:      
 
Domain Number 2 Region: 119-259,327-373
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000357
Family Ankyrin repeat 0.006
Further Details:      
 
Domain Number 3 Region: 713-945
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000249
Family Ankyrin repeat 0.0057
Further Details:      
 
Weak hits

Sequence:  A6R8V1
Domain Number - Region: 530-563,609-663
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00131
Family Pseudo ankyrin repeat 0.036
Further Details:      
 
Domain Number - Region: 422-563
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00403
Family Ankyrin repeat 0.014
Further Details:      
 
Domain Number - Region: 711-711
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0189
Family Ankyrin repeat 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A6R8V1
Sequence length 1511
Comment (tr|A6R8V1|A6R8V1_AJECN) Uncharacterized protein {ECO:0000313|EMBL:EDN09575.1} KW=Complete proteome; Reference proteome OX=339724 OS=(Histoplasma capsulatum). GN=HCAG_06742 OC=Eurotiomycetidae; Onygenales; Ajellomycetaceae; Histoplasma.
Sequence
MRTLNVSGAVAFNQGSGCSWRARETSRLEQLAPDAVIKLNVACPRLVREYVSFAREGDEG
IAESLLKQKRQETFASKSHIFRRQPSKRAFSNHEIHAVIEQLVRTDGSLGVLDYLLTKSN
DAKLEKHLFKQQRQHVTKSDIGSLLIWAARMQHPSMVYLLSLHSDETGLNEALDVVVSGR
HMECTKTLLQNGGDANFCQQAFLAAVARGDTPLVELLLSAEKRIAASCLDQALPSAVAVG
RFDLVSALLKSGADGNVPGALESAVRARSRDIVIAFILADHPPSKTSLDRAVEVAFDEIE
SGSDLQRTLIEIILCGGANGEAVPKILFKAVERNDEKLVSLLVTYGASVTYNSAEAIIHA
IKMGNTNLLASLFSARIDGQYASHILTMLPKIASSIPPSKQLAIISTLVERGACGYALHP
CLVDAVQRNYYTIVEYLVQKHASVDYDNAEALRCAVSSVSLPLFELLLKGCPSKESLELC
FPLLEAVPSKPRLIMAGRLLAAGAKGVEVENALIKAVMSDFTMEKMPLIYEFVRHGTDVN
VHAGKCFRESAAAGDIDALKLLLKGVPSPASLAQGIIPALNLPNSDLRFAILDLLVSAAG
IKGETLDSGLITAQRQPWSHPSLMELLLKFGANVNFKNGAVVRKAIKNSDDKQLKILVSN
APSTDTLGVALDVLLKTNTSTKNQMAAILLDAGRDRMPKIINEFLAEAVRLKSDTSLVKL
ILGFGASINDGDGQALALSIETCSFDIMTILLEHGVANESLETGFSSAWALQGAERFQYT
SRILQAGYDGPHIHRALVETVKESVVDTETLKLLLNHGASVHCSNNLPLLHAAMSMDAAT
LKLLLEAVSDRGAINDVFSQMTSAGNTWLSPAGLLVIKQLLENGACGEVIDSALAVSVES
FGIIADATDAVDLFIRFGANADYDNGRALNIAVAKNSPVLVRRLLGSVKSTVNLLAAFSA
ILSSNLPEDTTLELIKIFTQIPGGIPDLNSYMYDEDGTQREPVTFAALRKWPRGTKILEA
LLKADILVDQTIPYVIESKEGYEQVSLLLWAFLQPQQKISPYVIDCLLRNGANPNFQSTG
SHQTPLLVATMERTPDIVHTLIQHGADVSICDIYGRTPLLYASKRGQVATLRHLLNANPG
VDDGSIHEAARELHFDAVKLLLDYGHDPNFPSMAHDGRSALGELCLNAAADSATSFGKLR
QTIDILVAGKAELISDRGRKPLLIHALDNPTGCTNVTKALLAGGLWRRVNDEKNLYSQDG
FVFSPTMYLTKGLQNSSKEYVPDLLHILKANGCKDVFYKQEGPQPPDMVGAPQDILEEER
RRKARERRLEEQEEEHQLALKREMEVAEQQNLVMKKAHTLRIQQDREVAENRDAATANSA
ALQLRLEATTAAQRQGIADQQRHADLQQQRALNQIRLEATKEEGRLQIEFQKTSAAIQQN
VFDGRVQAESRRLKELETANERQYKRDTELLSRQERAMASRKAMMADARGFALPAINEPQ
RRIGQGDLSPD
Download sequence
Identical sequences A6R8V1
XP_001539137.1.38663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]