SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A6RA66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6RA66
Domain Number 1 Region: 56-211
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.0000000000000916
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00051
Further Details:      
 
Domain Number 2 Region: 375-383,437-547
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000209
Family Pseudo ankyrin repeat 0.041
Further Details:      
 
Weak hits

Sequence:  A6RA66
Domain Number - Region: 534-590
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0017
Family Pseudo ankyrin repeat 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A6RA66
Sequence length 632
Comment (tr|A6RA66|A6RA66_AJECN) Uncharacterized protein {ECO:0000313|EMBL:EDN10051.1} KW=Complete proteome; Reference proteome OX=339724 OS=(Histoplasma capsulatum). GN=HCAG_05854 OC=Eurotiomycetidae; Onygenales; Ajellomycetaceae; Histoplasma.
Sequence
MPGVALTNGCAGIEIAADTRVYENKNAATVSEVEVELNNNNGMSSADPPCNKNARKHVLL
STNASFAKVAIPFLLKMADVELRVISDDVLDFTQGACYPDTPISAQPGSKLSTRPWMNVT
AAELIYWADVLVLGSVGAGTLGAMIAGLTTSLTLTILRGWDISKRVFLVPGMTTSEWQFP
MTKRQLSNLATFWPRIKVLPPTLSKFEHPAGLVEIPWDGWTVFSSEVRNACSSLPGPMQE
DNKLANNVCSGTRPTPLVISSNLHERQQETNEEPNQPGTKSQPTSAICKERPILPPELLT
MIFEMLGDWETATSVGVYAKIPVPEQWKPYIPTARSPATFEYIVLRGSIKEIEEQLSTIP
PRKPLSRIATDLILKFSRTDILDTLCRLRMDLYLSTPDLKNLPLSASSKFGSTSLLTWWH
KSSIPPTLPIKDYLPEAIDAASRAGFVDVLEWWRQSGLPFRYTERSLESASAEGQIAVLD
WWKTVSKNAPLGNPVPLKVGKSVLLAAQSGRTDSLAWWDKSDIPFSHAESVTRIASNHGH
VPVLDFWHRRKREKLIFDNQVLVGATKNGHVEVLEWWKRSGLPVEFKTCDIEEALEDAVS
GVEQRVRRWWAQNGLNLGVGTNEWMMVKTLNT
Download sequence
Identical sequences A6RA66
XP_001538249.1.38663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]