SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A6TX66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A6TX66
Domain Number - Region: 5-40
Classification Level Classification E-value
Superfamily RecG, N-terminal domain 0.0235
Family RecG, N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A6TX66
Sequence length 71
Comment (tr|A6TX66|A6TX66_ALKMQ) Uncharacterized protein {ECO:0000313|EMBL:ABR50784.1} KW=Complete proteome; Reference proteome OX=293826 OS=Alkaliphilus metalliredigens (strain QYMF). GN=Amet_4716 OC=Alkaliphilus.
Sequence
MGGFKKVKYFLKYVLKLNKMEEKKKPAVIKNAGFMVGSFDGLVSIFFRIGSTDNKAIRER
VMLPPPYQMNH
Download sequence
Identical sequences A6TX66
293826.Amet_4716 gi|150392394|ref|YP_001322443.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]