SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A6UUW5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6UUW5
Domain Number 1 Region: 1-49
Classification Level Classification E-value
Superfamily Nop10-like SnoRNP 1.57e-19
Family Nucleolar RNA-binding protein Nop10-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A6UUW5
Sequence length 51
Comment (sp|A6UUW5|NOP10_META3) Ribosome biogenesis protein Nop10 {ECO:0000255|HAMAP-Rule:MF_00803} KW=Complete proteome; Reference proteome OX=419665 OS=Nankai-3). GN=Maeo_0704; OC=Methanococcaceae; Methanococcus.
Sequence
MRMKKCPNCKNYTLNTICQCGEKTITVKPPRYSPTDKYGKYRRMLKKSIKQ
Download sequence
Identical sequences A6UUW5
gi|150401133|ref|YP_001324899.1| WP_011973419.1.55018 419665.Maeo_0704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]