SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A6ZSX9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6ZSX9
Domain Number 1 Region: 2-56
Classification Level Classification E-value
Superfamily Nop10-like SnoRNP 1.83e-21
Family Nucleolar RNA-binding protein Nop10-like 0.0000389
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A6ZSX9
Sequence length 58
Comment (tr|A6ZSX9|A6ZSX9_YEAS7) H/ACA-box snoRNPs component {ECO:0000313|EMBL:EDN62310.1} KW=Complete proteome OX=307796 OS=Saccharomyces cerevisiae (strain YJM789) (Baker's yeast). GN=SCY_2463 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MHLMYTLGPDGKRIYTLKKVTESGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ
Download sequence
Identical sequences A6ZSX9 B3LSJ0 C7GWT4 C8Z9L3 G2WFE5 N1P2N0 Q6Q547
YHR072W-A YHR072W-A YHR072W-A YHR072W-A YHR072W-A YHR072W-A NP_058135.1.97178 YHR072W-A YHR072W-A YHR072W-A YHR072W-A YHR072W-A YHR072W-A d1y2ya_ YHR072W-A YHR072W-A 1y2y_A 3u28_B 3uai_B YHR072W-A YHR072w-a YHR072W-A YHR072W-A YHR072W-A 1y2yA SCRT_04785 YHR072W-A YHR072W-A YHR072W-A YHR072w-a___KOG3503 YHR072W-A tr|A6ZSX9|A6ZSX9_YEAS7 YHR072W-A 4932.YHR072W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]