SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7ATK6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A7ATK6
Domain Number - Region: 217-262
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 0.0955
Family N-terminal domain of cbl (N-cbl) 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A7ATK6
Sequence length 268
Comment (tr|A7ATK6|A7ATK6_BABBO) Uncharacterized protein {ECO:0000313|EMBL:EDO06267.1} KW=Complete proteome; Reference proteome OX=5865 OS=Babesia bovis. GN=BBOV_II003120 OC=Babesiidae; Babesia.
Sequence
MTASDCTIFFKSHIKYIKAYDDEKFTKEDSAVTRDRILNLPLATEITVRYVEQGGGTPED
VTLFAEWLIPMQKYYGFNQEISSLLSKFYFTLSQRPAMFNIDHMHRILQSTCKVFNQLDT
DSTNHAKAFMESLLHESERRNDVHTFDNAFNTLCALQKRGHWRFELLKGLLGNECLDLIL
GMLYTVVNNYDSRQHHRNIQELIVNLIETIDNVQGQRFAMNVPFALDLCPGTMAHLKVVE
STYNDTFLQLKHMLKLLQDRNDNILAKA
Download sequence
Identical sequences A7ATK6
gi|154797087|gb|EDO06267.1| gi|156084704|ref|XP_001609835.1| gi|156084704|ref|XP_001609835.1| XP_001609835.1.62033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]