SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7BE91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A7BE91
Domain Number - Region: 39-113
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 0.00942
Family PA0094-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A7BE91
Sequence length 157
Comment (tr|A7BE91|A7BE91_9ACTO) Uncharacterized protein {ECO:0000313|EMBL:EDN81515.1} KW=Complete proteome OX=411466 OS=Actinomyces odontolyticus ATCC 17982. GN=ACTODO_01993 OC=Actinomyces.
Sequence
MTLSSGWRFLTPEEHAQLGLLADDPSVRLVAVAQTKDEGNVPTFVVTGGVLSTNASDDEV
YADSVRQVEEALPGFHLIDDFAWPVHPEGARWRTGVYILDDVSLTLSQLTWMTHIAPTMQ
RPPQRFLWTATCTCPSILFPTIIDDFITMAQTLEVTP
Download sequence
Identical sequences A7BE91
WP_003793203.1.82230 ACTODO_01993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]