SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7GB53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7GB53
Domain Number 1 Region: 1-84,168-260
Classification Level Classification E-value
Superfamily PHP domain-like 2.62e-43
Family PHP domain 0.0039
Further Details:      
 
Weak hits

Sequence:  A7GB53
Domain Number - Region: 102-177
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0641
Family Pseudo ankyrin repeat 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A7GB53
Sequence length 272
Comment (tr|A7GB53|A7GB53_CLOBL) PHP domain protein {ECO:0000313|EMBL:ABS39825.1} KW=Complete proteome OX=441772 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F). GN=CLI_0732 OC=Clostridium.
Sequence
MIYADLHVHTNHSDGICEIANVLDMAKKKGIKAIAITDHDTVDQFDEINELGRKMDLEVV
KGVEMSCYDYDVFKKVHIVGLWLNKNATHVKKLCDKTLKCRDNYHRDLIKELSEKGYDIT
YEDAKKYSKYSIVFKMNIFQALKEKYKDEMTKERYNELFASKTSKETDLKMGYTPVMEGI
EAIKKDGGIPIIAHPCQYDNYDEIEKYVEYGLQGIEINHSKMKKIDYKKTLDFAAKHNLA
KSGGSDFHDPDLIEFGCYGLTKEQYEELKHFR
Download sequence
Identical sequences A7GB53
441772.CLI_0732 WP_011987609.1.24613 WP_011987609.1.68062 WP_011987609.1.82254 WP_011987609.1.96435 gi|384461082|ref|YP_005673677.1| gi|153938431|ref|YP_001390013.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]