SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7RLB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7RLB9
Domain Number 1 Region: 6-33
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000104
Family Ran binding protein zinc finger-like 0.0039
Further Details:      
 
Weak hits

Sequence:  A7RLB9
Domain Number - Region: 158-183
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00016
Family Ran binding protein zinc finger-like 0.0033
Further Details:      
 
Domain Number - Region: 85-111
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00033
Family Ran binding protein zinc finger-like 0.0035
Further Details:      
 
Domain Number - Region: 223-330
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0667
Family Pseudo ankyrin repeat 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A7RLB9
Sequence length 685
Comment (tr|A7RLB9|A7RLB9_NEMVE) Predicted protein {ECO:0000313|EMBL:EDO47663.1} KW=Complete proteome; Reference proteome OX=45351 OS=Nematostella vectensis (Starlet sea anemone). GN=v1g160052 OC=Edwardsiidae; Nematostella.
Sequence
MPKNEQNLKWSCGYCTYLNWPTATKCTLCLAARPTNIICPQSVRAPGISEDIYQTADNER
IISSNTLNCRSADRTSNKKKPSEQEVTKWKCPTCTFDNWPNALRCVMCHNNAPKSRTLYA
EASSAKEAKALSPKSSRSKVNLKTLNNDKNKAQLKNLTKWQCPNCTYENWPKTAKCVICG
TTKPLGKPSDEPKMSKNQNLASHKASGSRRRSPSSSLTDMSAIQSSNQEAKNIIYDIPAS
EDVNDNEEVMQIRNRLKDCDWMWLSACIGVVEGDAASVETYLNSGGDRTRQLTREDCVVL
NRPGIFEVGFTLVHLAIRFKRDDLLAFLLAPEVTNHRLRCVPCLVSPELAGDIRKEIAHT
MRQKKGDWPCFFFTDQVTFVLPAEIQDFPGRVQRQLFEDFFDKEVQRVLEVESPVINWSV
EITEQLGSRIFPLWNRSAGDCLLDSLLQATYGVFDKDNTLRKALFESLSEGSSRFFARYK
EWESMQAETLQYSLDEDQWEQDWASILSLASQPGTSLEQTHVFALAHILRRPVIIYGVKY
VKSFRGETLGLARFQGVYLPLLWERSFCWKNPVVLGYTRGHFSALVAMEVDTDASNDIGA
HAHVENNDNVHVTYLPLVDHEGRLLPVHFLSASEVGSEEMLLRDWLDCCVTEGGVLVAQQ
RVTPRPALVNQMIDDWLDRYRKLSK
Download sequence
Identical sequences A7RLB9
jgi|Nemve1|160052|estExt_gwp.C_120014 45351.JGI160052 XP_001639726.1.94760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]