SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7RQQ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A7RQQ1
Domain Number - Region: 47-120,165-205
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0131
Family Pseudo ankyrin repeat 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A7RQQ1
Sequence length 237
Comment (tr|A7RQQ1|A7RQQ1_NEMVE) Predicted protein {ECO:0000313|EMBL:EDO46204.1} KW=Complete proteome; Reference proteome OX=45351 OS=Nematostella vectensis (Starlet sea anemone). GN=v1g90013 OC=Edwardsiidae; Nematostella.
Sequence
MPCLHIILQHAVSPHHLTTCRVSTSSYNMPCLHIILQHAVSPHGLTTCRVSTWSYNMPCL
HMVLQHAVSPHGLTTCRVSTSSYNMPCLHMVLQHAVSPHSLTTCRVSTSSHNMPCLHIVL
QHAVSPHGLTTCRVSTSSYNMPCLHIVSQHAVSPHHLTTCRVSTSSHNMPCLHILLQHAV
SPHGLTTCRVSTSSHNMPCLHIILQHAVSPHGLTTCRVSTSSYNMPCLHMVFQHAVS
Download sequence
Identical sequences A7RQQ1
XP_001638267.1.94760 45351.JGI90013 jgi|Nemve1|90013|e_gw.23.91.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]