SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7RSZ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A7RSZ7
Domain Number - Region: 1-29
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0523
Family Pseudo ankyrin repeat 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A7RSZ7
Sequence length 523
Comment (tr|A7RSZ7|A7RSZ7_NEMVE) Predicted protein {ECO:0000313|EMBL:EDO45311.1} KW=Complete proteome; Reference proteome OX=45351 OS=Nematostella vectensis (Starlet sea anemone). GN=v1g92648 OC=Edwardsiidae; Nematostella.
Sequence
PLVVAAQLGNYEVLNMLVSKGFQLVKPHNVLCRCEECQADNFRESQRRLDIYRGLANPVF
ISMTSNDPFLTAFELSSELEVIARREDEYEKDYLQLSQQCSQFTIGLLDECRTSREQRCI
LNYPGENGSVEDYAENSLGLVNSAISYNQKEFVAHPFCQHLVMQHIFGDITGWRTNHFLY
RIAYVLTQVIIFPVLAVIYFFMPFLEVGRKIKRPFVKFINHTSSFVVFLILLAVSSHHQF
EIRFRKMPSGLEWLIFSWILGVAWSECKQVWHEGARRYFSSGWNWMDIGMVFLLLGAFVL
WTIIFIVDFDSNAKLAHDVLLSTADGMYAFGVVASFFRLIYLCQISRYLGLLQLSLSRMV
RVIFQFAFISCVVLWSFSVAMTMLYMSSFEAYQLPRPVKNVTSDIDAILDKGYDNLLSTM
VTLMWASLDMVGLDTLNVFKKQSLIQFWTAALFTLYHAASMVVLLNMLIAMMSNSYQQVE
DNIETEYKFARTQLWTDYIGDAVPTLPPPLNLLPTPKYIVRLL
Download sequence
Identical sequences A7RSZ7
XP_001637374.1.94760 45351.JGI92648 jgi|Nemve1|92648|e_gw.30.215.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]