SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7SWD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A7SWD3
Domain Number - Region: 22-94
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0248
Family Pseudo ankyrin repeat 0.045
Further Details:      
 
Domain Number - Region: 102-194
Classification Level Classification E-value
Superfamily PSPTO4464-like 0.0902
Family PSPTO4464-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A7SWD3
Sequence length 225
Comment (sp|A7SWD3|GID8_NEMVE) Glucose-induced degradation protein 8 homolog KW=Complete proteome; Reference proteome OX=45351 OS=Nematostella vectensis (Starlet sea anemone). GN=v1g247787; OC=Edwardsiidae; Nematostella.
Sequence
MSFAEEVNREEWMEKIGKLRFQRAEMNRLIMDYLVTEGYKEAAEKFRIESGTQPTAPLDS
LDDRIKIREAVQKGDLEQAVSMTNKLNPDILDSNQQLYFHLQQQRLIELIREKDIEAAVE
FAQGQFSEQGQESGRYLEELEQTMALLAFDNPEESPFGDLLHTSQRQKVASELNAAILEA
EHKKTQPKLANVLKLLLWAQDELEGKKVKFPKMAEIASGTFEESR
Download sequence
Identical sequences A7SWD3
XP_001624093.1.94760 45351.JGI247787 jgi|Nemve1|247787|estExt_fgenesh1_pg.C_3510020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]